SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6XHL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6XHL1
Domain Number 1 Region: 37-194
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-35
Family Glutathione peroxidase-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C6XHL1
Sequence length 201
Comment (tr|C6XHL1|C6XHL1_LIBAP) Cytochrome-c oxidase assembly factor protein {ECO:0000313|EMBL:ACT56754.1} KW=Complete proteome OX=537021 OS=Liberibacter asiaticus (strain psy62). GN=CLIBASIA_00830 OC=Rhizobiaceae; Liberibacter.
Sequence
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI
VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR
IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK
DDSDSAIEKINRLITYGNVVK
Download sequence
Identical sequences C6XHL1
gi|254780281|ref|YP_003064694.1| 537021.CLIBASIA_00830 gi|470204643|ref|YP_007598741.1| WP_012778500.1.15810 WP_012778500.1.15976 WP_012778500.1.16756 WP_012778500.1.18731 WP_012778500.1.3509 WP_012778500.1.50033 WP_012778500.1.77054 WP_012778500.1.78654 WP_012778500.1.79050 WP_012778500.1.94010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]