SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7CHE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7CHE0
Domain Number 1 Region: 5-287
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.24e-75
Family Epoxide hydrolase 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7CHE0
Sequence length 288
Comment (tr|C7CHE0|C7CHE0_METED) Putative alpha/beta hydrolase, putative epoxide hydrolase {ECO:0000313|EMBL:CAX26440.1} KW=Complete proteome OX=661410 OS=(Methylobacterium dichloromethanicum (strain DM4)). GN=METDI4825 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MSDPAVSHRHIDLRGLRLHVAEAGPADGVPTILLHGFPEFWFGWRHQIGPLAGSGLRLLI
PDQRGYGLSDRPKGIAAYHLDRLAQDVIALADACGLARFNLVGHDWGGLVAFWVASFHPE
RVERLAALNACHPGVFGPYLRRHPGQALRSAYAGFFQLPLLPERVLTAREGRLLRALMRR
SSAPGSFTEADLDVYAREWLRPGAVSAMLNWYRALAQLPRERHPPKIVAPTLILWGERDQ
ALQTGLAEASLDLCERGRLQRFPQATHWVQHDAPEAVNAALIDFLGRS
Download sequence
Identical sequences C7CHE0
661410.METDI4825 WP_015824030.1.60027 gi|254563162|ref|YP_003070257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]