SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7DYB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7DYB7
Domain Number 1 Region: 22-299
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.87e-26
Family Proline iminopeptidase-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7DYB7
Sequence length 353
Comment (tr|C7DYB7|C7DYB7_SENSQ) ORSF21B {ECO:0000313|EMBL:ACT21092.1} OX=121554 OS=Senecio squalidus (Oxford ragwort). GN=ORSF21B OC=Asteroideae; Senecioneae; Senecioninae; Senecio.
Sequence
MALSRPSISVDLPNIDIDGKEHIIRTGGGLVSVTVYGDQAKPPLITYPDIALNHTTCFHG
LFISPDSASLLLHNFCIYHISPPGHELGAATISSDDPVPSVIDLSDQILEILNYFRLGSV
MCMGAMAGAYILTSFALKYSERVTGLILVSPLCRAPSWNEWFYNKLMSKMLYYYGISDLL
KELLIHRYFSKEVCGNLERPESDMVRACRKLLAERDSINVWRYLQAIDRRQGITEELESL
ECKTIIFVGDSSPFHDEALYMSAKLGRDSSTLVEVHACGSMVTEEQPHAMLIPLEYFLKR
FGFYRLCQYNDSPRSPLDLCCKNPKLLYPKHMGLKLRPIKTRVSPPQPRTSGS
Download sequence
Identical sequences C7DYB7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]