SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7FFE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7FFE4
Domain Number 1 Region: 3-187,216-316
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-51
Family Duffy binding domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7FFE4
Sequence length 352
Comment (tr|C7FFE4|C7FFE4_PLAFA) VAR2CSA {ECO:0000313|EMBL:ACT97160.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var2csa OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
KCEKCESEQSKKNNKYWIWKKSSGNGEGLQEEYANTIALPPRTHSLCLVCLHEKEGKKTQ
ELKNIRTNSELLKERIIAAFHEGKNLKTSPQNKNDNGKKLCKDLKYSFADYGDLIKGTSI
WDNEYTKDLELNLQKIFGKLFRKYIKKNNTAEQHTLYSSLDELRESWWNTNKKYIWLAMK
HGAGMNSTMCNADGSVTGSSDSGSTTCCGDNGSISCDDMPTIDLIPQYLRFLQEWVEHFC
EQRQEKVNAVITNCKSCKECGGTCNSDCEKKCKAYKEFIEKCKGGGTEGTSGSSWSKRWD
QIYKRHSKHIEDAKRNRKAGTKNCGITTGTISGESSGANSGVTTTENKCVQS
Download sequence
Identical sequences C7FFE4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]