SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7GJU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GJU6
Domain Number 1 Region: 101-205
Classification Level Classification E-value
Superfamily TPR-like 3.4e-32
Family Tetratricopeptide repeat (TPR) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7GJU6
Sequence length 346
Comment (tr|C7GJU6|C7GJU6_YEAS2) Sgt2p {ECO:0000313|EMBL:EEU08914.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_00469 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF
KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL
AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK
YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA
SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE
GFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ
Download sequence
Identical sequences A0A0L8VHJ4 A0A250WB02 A6ZNL2 B3LJ62 C7GJU6 C8ZHX0 E7M068 E7NNB5 E7Q966 G2WMN7 H0GNC2 N1NY70 Q12118
YOR007C YOR007C YOR007C YOR007C YOR007C YOR007C tr|A6ZNL2|A6ZNL2_YEAS7 YOR007C YOR007C YOR007C YOR007C 4932.YOR007C YOR007C YOR007C YOR007C YOR007C SCRT_01409 YOR007C YOR007C NP_014649.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]