SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7GPS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GPS5
Domain Number 1 Region: 7-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.9e-31
Family spliceosomal protein U5-15Kd 0.00000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7GPS5
Sequence length 143
Comment (tr|C7GPS5|C7GPS5_YEAS2) Dib1p {ECO:0000313|EMBL:EEU07194.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_02313 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MASVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIY
LCDIDEVSDFDEMYELTDPMTVMFFYQNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETI
FRGARKNKGLVVSPYDYNHKRVS
Download sequence
Identical sequences A0A0L8VG54 A0A250WE14 A6ZWW7 B3LK52 C7GPS5
YPR082C YPR082C tr|A6ZWW7|A6ZWW7_YEAS7 SCRT_02564 YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]