SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7GQ33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GQ33
Domain Number 1 Region: 22-227
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-75
Family Dcp1 0.00000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7GQ33
Sequence length 231
Comment (tr|C7GQ33|C7GQ33_YEAS2) Dcp1p {ECO:0000313|EMBL:EEU07088.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_02426 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MTGAATAAENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLE
YQGVLAIYLRDVSQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKS
NDSLTYNCGKTLSGKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLE
CMGVEVKDELVIIKNLKHEVYGIWIHTVSDRRNIYELIKYLLENEPKDSFA
Download sequence
Identical sequences C7GQ33
YOL149W YOL149W YOL149W YOL149W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]