SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7GQI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GQI1
Domain Number 1 Region: 162-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000103
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7GQI1
Sequence length 220
Comment (tr|C7GQI1|C7GQI1_YEAS2) Nrg2p {ECO:0000313|EMBL:EEU06947.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_02597 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSIGYKDNLMSTILAKDRKCEFPINFECSPSQITLMPEMFSFNNERKYQTLIPLIKTSHL
IDDDLKDKLNKCAFDFFSGKQANRTSDGTISRLTASGKTSPILPLQNINIVKAENTGNGK
SDPYSSIKISKPTKTVIKLKSTKTNTAGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKN
HICPHEGCGQRFSRHDNCNQHYRTHANKKKRNWKRRETSS
Download sequence
Identical sequences C7GQI1
YBR066C YBR066C YBR066C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]