SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7GQP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GQP9
Domain Number 1 Region: 35-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-17
Family HkH motif-containing C2H2 finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7GQP9
Sequence length 166
Comment (tr|C7GQP9|C7GQP9_YEAS2) Bud20p {ECO:0000313|EMBL:EEU06864.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_02663 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MGRYSVKRYKTKRRTRDLDLIYNDLSTKESVQKLLNQPLDETKPGLGQHYCIHCAKYMET
AIALKTHLKGKVHKRRVKELKGVPYTQEVSDAAAGYNLNKFLNRVQEITQSVGPEKESNE
ALLKEHLDSTLANVKTTEPTLPWAAADAEANTAAVTEAESTASAST
Download sequence
Identical sequences A0A250WM55 C7GQP9 G2WIR6 N1P6F1
YLR074C YLR074C YLR074C YLR074C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]