SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7GT98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C7GT98
Domain Number - Region: 184-223
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.00183
Family DNA polymerase beta, N-terminal domain-like 0.022
Further Details:      
 
Domain Number - Region: 658-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0754
Family HkH motif-containing C2H2 finger 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7GT98
Sequence length 704
Comment (tr|C7GT98|C7GT98_YEAS2) Dbf4p {ECO:0000313|EMBL:EEU05976.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_03639 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MVSPTKMIIRSPLKETDTNLKHNNGIAASTTAAGHLNVFSNDNNCNNNNTTESFPKKRSL
ERLELQQQQHLHEKKRARIERARSIEGAVQVSKGTGLKNVEPRVTPKELLEWQTNWKKIM
KRDSRIYFDITDDVEMNTYNKSKMDKRRDLLKRGFLTLGAQITQFFDTTVTIVITRRSVE
NIYLLKDTDILSRAKKNYMKVWSYEKAARFLKNLDVDLDHLSKTKSASLAAPTLSNLLHN
EKLYGPADRDPRTKRDDIHYFKYPHVYLYDLWQTWAPIITLEWKPQELTNLDELPYPILK
IGSFGRCPFIGDRNYDESSYKRVVKRYSRDKANKKYALQLRALFQYHADTLLNTSSVNDQ
TKNLIFIPHTCNDSTKSFKKWMQEKAKNIEKTELKKTDDSAVQDVRNEHADQTDEKNSIL
LNETETKEPPLKEEKENKQSIAEESNKYPQRKELAATPKLNHPVLATFARQETEEVPDDL
CTLKTKSRQAFEIKASGAHQSNDVATSFGNGLGPTRASVMSKNMKSLSRLMVDRKLGVKQ
TNGNNKNYTATIATTAETSKENRHRLDFNALKKDEAPSKETGKDSAVHLETNRKPQNFPK
VATKSVSADSKVHNDIKITTTESPTASKKSTSTNVTLHFNAQTAQTAQPVKKETVKNSGY
CENCRVKYESLEQHIVSEKHLSFAENDLNFEAIDSLIENLRFQI
Download sequence
Identical sequences C7GT98
YDR052C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]