SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7GVB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GVB8
Domain Number 1 Region: 20-486
Classification Level Classification E-value
Superfamily TPR-like 1.31e-18
Family HAT/Suf repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7GVB8
Sequence length 544
Comment (tr|C7GVB8|C7GVB8_YEAS2) Prp42p {ECO:0000313|EMBL:EEU05251.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_04421 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MDKYTALIHDENFSTLTLNVSRYPKSLAYWEKLLNYIVKASAPICKSTEPQLLKLIRCTY
SSMLNEFPYLENYYIDFALLEYKLGNVSMSHKIFQRGLQAFNQRSLLLWTSYLKFCNNVI
SHQKQLFKKYETAEEYVGLHFFSGEFWDLYLEQISSRCTSSKKYWNVLRKILEIPLHSFS
KFYALWLQRIDDIMDLKQLSQLTSKDELLKKLKIDINYSGRKGPYLQDAKKKLKKITKEM
YMVVQYQVLEIYSIFESKIYINYYTSPETLVSSDEIETWIKYLDYTITLQTDSLTHLNFQ
RALLPLAHYDLVWIKYSKWLINSKNDLLGAKNVLLMGLKFSLKKTEIIKLLYSVICKLNE
YVLLRNLLEKIESSYSDNVENVDDFEIFWDYLQFKTFCQNSLYSSRYSDSQSNGLLNKEL
FDKVWKRLSCKEKKSGQEILLNNLVQFYSKDTVEFVEKNIFQKIIESGWEYYLQNGMFWN
CYCRLIYFDTSRSYLDKRQYIVRKIWPQIDKKFAQSVLPSLTEFCQSYFPEEMDTLEEMF
TEEP
Download sequence
Identical sequences A0A0L8VTB1 C7GVB8 E7QD24
YDR235W YDR235W YDR235W YDR235W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]