SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7GVR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GVR9
Domain Number 1 Region: 3-154
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.53e-22
Family Dual specificity phosphatase-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7GVR9
Sequence length 224
Comment (tr|C7GVR9|C7GVR9_YEAS2) YDR067C-like protein {ECO:0000313|EMBL:EEU05117.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_04565 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MTLVTPLQFSTVQPNLYRGSYPREINLPFLRTLRLKYILSLTPEPLSTDPLMVKFCEENN
IKTIHIKCQSERKADKTKPKIKRKKKTVPIEYDVVVRCVKFLIDKGHYPCYMHCTNGELI
ISLVVACMRKFSYWSTVSILNEFLVYNSSINIHERNFIENFNSEIEVDDLDIKDKVPWIT
VRYIARTATESKDELRVDDANASEKVARVSSVSNSLPKLKFHSM
Download sequence
Identical sequences A0A0L8VSV7 A0A250W993 A6ZY32 B3LGK3 C7GVR9 C8Z4Y5 E7KLH9 E7LSK7 E7NFM6 E7Q249 G2WAH1 H0GE27 N1P4L8 Q12454
NP_010352.1.97178 YDR067C YDR067C YDR067C YDR067C YDR067C SCRT_00448 YDR067C YDR067C tr|A6ZY32|A6ZY32_YEAS7 YDR067C YDR067C YDR067C YDR067C YDR067C YDR067C YDR067C 4932.YDR067C YDR067C YDR067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]