SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7GWP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7GWP9
Domain Number 1 Region: 116-263
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.43e-35
Family Dual specificity phosphatase-like 0.00000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7GWP9
Sequence length 281
Comment (tr|C7GWP9|C7GWP9_YEAS2) Siw14p {ECO:0000313|EMBL:EEU04779.1} KW=Complete proteome OX=574961 OS=Saccharomyces cerevisiae (strain JAY291) (Baker's yeast). GN=C1Q_04930 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MGLYQAKNDEGSDPKSSSKIDDLIENEAEIIRLIKEDGKLLIDNGDGRDIHNIIQEDKLL
SVEFNEVLKRFHGEEKSDIPRKEFDEDEDDRYDSNEHHQKTIEVMNTLNHVINKEVIPPE
NFSHVVGEIYRSSFPRQENFSFLHERLKLKSILVLIPEEYPQENLNFLKLTGIKLYQVGM
SGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTGCLIGCIRKLQNWSLTMIF
DEYRRFAFPKARALDQQFIEMYDDDEIKRIASKNNWLPLQW
Download sequence
Identical sequences A0A0L8VIS7 A0A250WH41 A6ZS58 B3LPQ4 C7GWP9 C8ZFK9 E7KHC6 E7NPL1 E7Q8Q1 G2WL39 H0GMR0
YNL032W YNL032W YNL032W YNL032W tr|A6ZS58|A6ZS58_YEAS7 YNL032W YNL032W YNL032W YNL032W YNL032W SCRT_03159 YNL032W YNL032W YNL032W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]