SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7LRA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7LRA6
Domain Number 1 Region: 327-604
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 6.93e-64
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 106-180
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000746
Family YkuI C-terminal domain-like 0.069
Further Details:      
 
Domain Number 3 Region: 582-650
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000183
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 
Weak hits

Sequence:  C7LRA6
Domain Number - Region: 174-265
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0573
Family Sensory domain of two-component sensor kinase 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7LRA6
Sequence length 650
Comment (tr|C7LRA6|C7LRA6_DESBD) Methyl-accepting chemotaxis sensory transducer with Cache sensor {ECO:0000313|EMBL:ACU89252.1} KW=Complete proteome; Reference proteome OX=525897 OS=(Desulfovibrio baculatus). GN=Dbac_1148 OC=Desulfomicrobiaceae; Desulfomicrobium.
Sequence
MKSIPIRMKLIGGFLALLILVCTGLGFIAYDRAKSASLSQVQENIQLMAQDGARLVRSRL
DFFLMGLEGIANRDVIRSMNWDRQLLTLEREIERMKYLGMGVIDADGQAKYPDGSTADLS
DRAYFKEAMAGKSVLSNVIISRVTNSPVIILATPIRGFAGDVKAVLLARLDATMLSEITD
NIKYGDTGYSYIIDGTGVLIAHGNRQFVLDQRNFVEEGKKDPQYASLGAMFQRMMKGEIG
FDQYPFMGSDRFFGFAPIENTGWSIAVGAMQDDVLTEVYRMRWMIGLASLAFFAVGIAIA
LLISRAILLPVKNCVDLLRDISEGEGDLTKRLPVESNDEIGQLAQHFNTFVEKLQRIIAE
ISGNAQTVASSATELSAVSKQTTQSVQSLSSKTSTVATAAEEMSANITSVAAGMEETTTN
LSSVAAATEEMTSTIGEISGNTERARGTTDNAARQVDNFAGILRDLGASAQEIGKVTDTI
SAISSQTNLLALNATIEAARAGEAGRGFAVVANEIKELATKTAEATNDIRTKINGIQNAT
GSAVTDIGQIVKVIGDVNEIVTTIAAAIEEQSAVTREVATNINQATTGVQDASVRASEMS
GVSRDIAQDITAVDSITGDIRSGGEQVQASAEELSKLAEQLKGLVGQFRI
Download sequence
Identical sequences C7LRA6
gi|256828940|ref|YP_003157668.1| WP_015773350.1.63071 525897.Dbac_1148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]