SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7P874 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7P874
Domain Number 1 Region: 273-552
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.86e-146
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000114
Further Details:      
 
Domain Number 2 Region: 4-272
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 5.89e-145
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7P874
Sequence length 553
Comment (tr|C7P874|C7P874_METFA) Methyl-coenzyme M reductase subunit alpha {ECO:0000256|PIRNR:PIRNR000262} KW=Complete proteome OX=573064 OS=(Methanococcus fervens). GN=Mefer_0938 OC=Methanocaldococcaceae; Methanocaldococcus.
Sequence
MEAEKRLFLKALKEKFEEDPKEKYTKFYIFGGWRQSARKREFVEVAQKLIEKRGGIPFYN
PDIGVPLGQRKLMPYKVSNTDAIVEGDDLHFMNNAAMQQFWDDIRRTVIVGMDTAHAVLE
KRLGVEVTPETINEYMETINHALPGGAVVQEHMVEVHPGLVWDCYAKIFTGDDELADEID
KRFLIDINKLFPEEQAEQIKQAIGKRTYQVSRVPTLVGRVCDGGTIARWSAMQIGMSFIT
AYKLCAGEAAIADFSYAAKHADVIQMASFLPARRARGPNEPGGIFFGVLADIVQTSRVSD
DPVEQSLEVVASGAMLYDQIWLGGYMSGGVGFTQYATATYTDDILDDFSYYGYDYITKKY
GGCNSVKPTMDVVEDIATEVTLYGLEQYDSFPALLEDHFGGSQRAGVTAAAAGITTALAT
GNSNAGLNGWYLSQILHKEYHSRLGFYGYDLQDQCGAANSLSFRNDEGSPLELRGPNYPN
YAMNVGHQGEYAGITQAAHSARGDAFALNPLIKVAFADPSLVFDFRYPRKEFARGALREF
EPAGERDPIIPAH
Download sequence
Identical sequences C7P874
gi|256810887|ref|YP_003128256.1| WP_015791493.1.34365 573064.Mefer_0938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]