SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7PVM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7PVM4
Domain Number 1 Region: 88-218
Classification Level Classification E-value
Superfamily Sortase 0.00000000000102
Family Sortase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7PVM4
Sequence length 235
Comment (tr|C7PVM4|C7PVM4_CATAD) Peptidase C60 sortase A and B {ECO:0000313|EMBL:ACU69380.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_0428 OC=Catenulispora.
Sequence
MRRAWTRGWPAVIAALLLASGCAAGSSTSAGGSGRNAGGTGTNPAAATAGGPAGSQAGGT
AGTPAGGTSGTSSAGNSTSAGAIARSDPVRLQIPAIGVDTSVMALGLAADGTVQVPPIEK
DSPAGWYNGSPTPGQTGPSVILGHVTVGKYGDGVFLKLAQLKPGAHVVVRLQDGASADFT
VDSVRTVAKAQFPTQEVYGNVNRPELRLITCGGERTSDGYLDNVLVFASLTGTAG
Download sequence
Identical sequences C7PVM4
gi|256389657|ref|YP_003111221.1| 479433.Caci_0428 WP_012784675.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]