SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7PW30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7PW30
Domain Number 1 Region: 43-352
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.86e-111
Family beta-glycanases 0.000000108
Further Details:      
 
Domain Number 2 Region: 382-485
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 9.77e-32
Family Cellulose-binding domain family II 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7PW30
Sequence length 487
Comment (tr|C7PW30|C7PW30_CATAD) Beta-xylanase {ECO:0000256|RuleBase:RU361174} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_4414 OC=Catenulispora.
Sequence
MHTDRTDRTDRTNRRLAAALAVIASCALAGSLALVRPAGAADTSLKQLSEAKGKYFGTAL
VQSNLSNSALVGVATSQFDMMTPGNEMKWDTTEPSNGSFNFGPGDTLVAFAQAHSMKVRG
HNLVWHSQLPGWVSSLPSSQVQAAMETHITTEATHYKGEVYSWDVVNEPFNEDGTLRQDA
FYNAMGTNYIADAIRTAHAADPNAKLYLNDYNIEGENAKSNAMYSLAQSLLAQGVPLGGI
GLESHFILGQVPSTMQANMQRFAALGLDVAVTELDDRIQLPASSANLQQQASDYSAVIGD
CLAVTRCVGVSQWGVGDADSWIPGTFSGYGAATMYDQNYQPKPAFNASIAALGGSSGSTS
PSSSTPSTPPTTSSSSPGGGGSAACKVSDVVSAWNTGLTENITIANTGSAAVNGWKLTFT
LASGQTVSNSWNATISPSSGQVTATNMSYNAAIAPGSSASFGFQATHTGNASAPSSFSLN
GQVCTNG
Download sequence
Identical sequences C7PW30
gi|256393555|ref|YP_003115119.1| 479433.Caci_4414 WP_015793007.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]