SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7PX82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7PX82
Domain Number 1 Region: 10-406
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 9.65e-33
Family Gtf glycosyltransferase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7PX82
Sequence length 419
Comment (tr|C7PX82|C7PX82_CATAD) Glycosyltransferase 28 domain protein {ECO:0000313|EMBL:ACU69433.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_0481 OC=Catenulispora.
Sequence
MTLFESPRLRVLFVAFSRSSLGHIVRSTTAAARFAADGHDVAVACHEEVRHIPEKAGLAW
LPIEEIGPAPAWRGMDDPEQLRAFVRTRLASPEYVSASLEDELRVIDLFRPDVVIADMRN
TAGVAASMRGVTAFTLHNLRLFQHPMHVVLPEVLVTLDQLGVEQAHARHVLGSTVLVPDI
AEIDGLSDVPRDTAALICSLTDEIRHLGPLLSPELLSVAARASESESGPGPRATENRRRL
LHVTLGGSGVGDQQIRRVVEAVAGLGLDIGVTLGAESLQDQVTALEDELAAVAGDSAVTV
TGFRHDVVERVAAADAAVVHGGHGSIIEALVCGTPLVFLPGSLEQRENARKIRELGLGVV
LAPDDDAAAVRAKVVKALSLKETPGPRRFARALVAADGAGRLVDYVTSSQAIRTAVAAP
Download sequence
Identical sequences C7PX82
479433.Caci_0481 WP_012784728.1.73754 gi|256389710|ref|YP_003111274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]