SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7Q035 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7Q035
Domain Number 1 Region: 48-458
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.44e-76
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000064
Further Details:      
 
Domain Number 2 Region: 472-784
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.7e-38
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000496
Further Details:      
 
Domain Number 3 Region: 830-934
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6.28e-31
Family Cellulose-binding domain family II 0.0000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C7Q035
Sequence length 935
Comment (tr|C7Q035|C7Q035_CATAD) Cellulose-binding family II {ECO:0000313|EMBL:ACU75528.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_6682 OC=Catenulispora.
Sequence
MRRSWKNAVSAVLGAVLAVAGLGVVSVSLSGSTAAAASAASAASGSGYTWQNVPIVGGGF
VPDVVFNTGAKNVAYARTDIGGMYRWNQSSSSWTPLLDWVGFTNWNEQGVVSVAADPVQT
NRVYAAVGMYTNSWDPNNGAILRSTDQGSTWSATPLPFKLGGNMPGRGMGERLMVDPNDD
AVLYMGMPSGHGLWKSTDYGVTWAQVTAFPNVGNYVQDSTDTTGYLSDNQGVAWVAFDKA
SGTTGAAGTPTKTIFVGVADVQNTVYESTNGGATWSRVAGQPTGFLAHKGLVDPTGAYLY
ITTSDKGGPYDGASGDVWKYAIASGTWTQISPVKSSDTSNDFYGYSGLTIDQQHPNTIMV
TGYSSWWPDTFIYRSTDGGATWTNAWSYNGYPTRVDKYTLDVSASPWLSWGNYPSPPEET
PKLGWMSEGLAIDPFNSDRMMFGTGATLYGTTNLTAWDSSTAKVKLSVMAQGIEETAVTD
LVSPPSGAPLLSALGDVDGFRHTDLTKVPAMMYQSPNWSTSTSIDYAEANPNDVVRVGNG
SSTVNSAAFSSDDGADWYAASSQPSGVTAGGTVAMAADGSAAVWSPTSAAVSYTTTTGSS
WTASTGIPAGAQVRSDRVNPKKFYGFNYATGTFYLSTDGGKTFTASAATNLPSGTGGAYV
HAVPGTEGDLWLAGGSTSGAYGLWHSTDSGATWTKLANVQQADNIGFGAPAPGRTNKALY
TIAEIGGVRGIFRSDDDGSTWTRINDDQHQWGNIGAAITGDPRVYGRVYVGTNGRGIVYG
TMTGTGSSSSSSPSTTPSTTPSTTPSTTPSTTPSTTPSATPSTTPSSSAPAGTCHVTYTK
ASEWGGGFTANITVANTGASPWTAWTVAWTYPGDQKVTNGWNATVTQTGAKVSATNVAYN
GSVASGSSASFGFQGTWTSNDTSPTAFSVNGAACS
Download sequence
Identical sequences C7Q035
gi|256395805|ref|YP_003117369.1| WP_015795257.1.73754 479433.Caci_6682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]