SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7Q0W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C7Q0W8
Domain Number - Region: 36-138
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.009
Family Cellulose-binding domain family III 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7Q0W8
Sequence length 435
Comment (tr|C7Q0W8|C7Q0W8_CATAD) Uncharacterized protein {ECO:0000313|EMBL:ACU69746.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_0811 OC=Catenulispora.
Sequence
MRIQRSARSVVAGVAGTCLVTVAMGVLAATPAQARGSATLTLGPNNGAPGSSFTASFHMS
APGGPNACLGATVTFTFDATALGTAGLDQSCAATVSLPVPPAATNGAHKVKAVASGGASA
TANATFTVTGSTATPTTTAPTKTAPPSWSNSTTPYPGWTAPPFASQVIPTSTGPCDTSGP
HATAPDKAFLQIPAYSVGAHPANNGSKVIVEPATGALPLVSVGPGGMIPPQLGDGRHPYQ
NLELMETIDPNVSSKLRLAAAAGEPFGCLHVESFGGTGSGYSYLSFALKDATVISVQDAN
ADGSLFETAAPSVPSASTPAPAPGGKTTGTAKGNAPAAPATPTPPAPKAKFEKVVLGYSS
LSWEYQEAAGGAQAPIHRGAGTIVPPAPPAPLSYSNLVFAFGGLVAAAVALMFAYHSRRR
DLARRQRRRKASHAS
Download sequence
Identical sequences C7Q0W8
gi|256390023|ref|YP_003111587.1| 479433.Caci_0811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]