SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7Q256 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C7Q256
Domain Number - Region: 70-198
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000183
Family Bifunctional DNA primase/polymerase N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7Q256
Sequence length 223
Comment (tr|C7Q256|C7Q256_CATAD) Bifunctional DNA primase/polymerase {ECO:0000313|EMBL:ACU77593.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_8778 OC=Catenulispora.
Sequence
MTVLSLPEGDLAEAGPAATDADPLGLKAAALNYIEERHWDILPGASVLRADGAWRCSCGN
TACPALGSHPAHRDWNKQITAQPSRVHSWWEEHPDSAILLPTGRTFDVIDVPEQAGCLAL
ARLERNGAALGPVAATPTRRLYFFVLPGTKKKIPEMLVRAGWGRAQLDLICHGEKGFVVA
PPSRMGTGGQVQWARPPGESNRWLPEAAELIPTLAYACGRERY
Download sequence
Identical sequences C7Q256
gi|256397870|ref|YP_003119434.1| 479433.Caci_8778 WP_015797317.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]