SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7QAJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7QAJ7
Domain Number 1 Region: 134-353
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.14e-38
Family PHB depolymerase-like 0.032
Further Details:      
 
Domain Number 2 Region: 413-517
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.02e-33
Family Cellulose-binding domain family II 0.0001
Further Details:      
 
Domain Number 3 Region: 29-115
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000000395
Family PHB depolymerase-like 0.017
Further Details:      
 
Domain Number 4 Region: 323-408
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000118
Family Cadherin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7QAJ7
Sequence length 518
Comment (tr|C7QAJ7|C7QAJ7_CATAD) Esterase, PHB depolymerase family {ECO:0000313|EMBL:ACU72496.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_3591 OC=Catenulispora.
Sequence
MLRSRSVKTRLLGLFAAVAAAVAVSLPAAPQAAAASLTQVTNFGTNPSNLAMYVYVPNNV
KPNPSILLAMHGCQGTASYMYSSTDFGKLADQYGFIVIYPQTNPSGSCWDVSSDQALKRN
GGSDPVGLMSMITYTEQHYGGNANSVFVTGESSGGMMTNVMLADYPDVFKAGAAFMGVPY
HCFYTGSVRGWNSPCANGQVSMTAQQWGDLVRNDGDPGYTGPRPRMQLWHGTADTTLNYN
NLGEEIKQWTNVDGVSQTPSSSDTPVANWNRTRYNNASGTTQVEAYSIVGAGHQLPIQGT
QMAAYAIHFMGLDGSGTTTGNTVTVTSPGNQSATVGTAISAVQVHATDSATGQSLTYSAT
GLPAGLSISSSGLISGTPTAAGTSTSTVTATDGTGASGSATFTWTVSGGGGTTPGTCHVA
YTRTNEWPGGFTANVTITNTGTAAINGWTVGWSFPGDQKITNAWSATATQSGAAVSAANV
AYDATIAPGANTSFGFQGTFTANDTSPSSFTVNGAACS
Download sequence
Identical sequences C7QAJ7
gi|256392773|ref|YP_003114337.1| WP_015792225.1.73754 479433.Caci_3591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]