SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7QAK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7QAK8
Domain Number 1 Region: 34-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-49
Family Xylanase/endoglucanase 11/12 0.00000511
Further Details:      
 
Domain Number 2 Region: 359-457
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.05e-32
Family Cellulose-binding domain family II 0.0000901
Further Details:      
 
Domain Number 3 Region: 264-352
Classification Level Classification E-value
Superfamily Fibronectin type III 6.28e-18
Family Fibronectin type III 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7QAK8
Sequence length 460
Comment (tr|C7QAK8|C7QAK8_CATAD) Cellulose-binding family II {ECO:0000313|EMBL:ACU72507.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_3603 OC=Catenulispora.
Sequence
MARLLRARALAAALAIAFTGALSAIALPAAQAATTTCSGTGTIPAGDYTIQANEWNSSAQ
QCLTYNGATAWTVSTANFNLGGSGAPATYPSIFKGCHWGLCTSNNPFPIQMSKLGSAVSS
WDTTQPSSGAYDVAYDIWFNSSPTATGQPDGTEVMIWMNSRGGVQPFGSQTGNTTVAGHN
WNVWTGQQSSWKIISYVLNPGATSLSNLDLKAMFQDAVSRGSINPSNYLLDVEAGFEIWQ
GGQGLGTNSFSVSATAAGSGGGDTTAPSVPANLAVTGTTASSASLSWSPSTDNVGVTGYR
VYRNGAQVGTSSGTTFTDTGLSAATHYTYTVAAVDAAGNVSAPSTGATATTTSNGGGGGG
SGCTAAYSVTNQWNSGFTANVTVTNSGTAPINGWKVNWTWGGGQQITSLWNGTLSSSGSA
VTVTNMGYNGSVAPGANTSFGFQGAYSGTNGTPTLTCTAS
Download sequence
Identical sequences C7QAK8
479433.Caci_3603 WP_015792236.1.73754 gi|256392784|ref|YP_003114348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]