SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7QF90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7QF90
Domain Number 1 Region: 351-637
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.55e-56
Family Type II chitinase 0.0013
Further Details:      
 
Domain Number 2 Region: 172-342
Classification Level Classification E-value
Superfamily Fibronectin type III 6.31e-27
Family Fibronectin type III 0.00027
Further Details:      
 
Domain Number 3 Region: 36-166
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000119
Family CBM4/9 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7QF90
Sequence length 648
Comment (tr|C7QF90|C7QF90_CATAD) Carbohydrate-binding CenC domain protein {ECO:0000313|EMBL:ACU74848.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_5990 OC=Catenulispora.
Sequence
MTSARTRLRAFAALLAATLIAATMTIALSASRARADSNLVVNSGFETGSLSPWTCDGSTG
SVVSSPVHSGSHALAGAANNSDDAQCTQTVSVQPNSAYTLSAYVEGGYVYIGATGYSSTW
TPSATSFQQLSTSFTTGASTTSVQIYLHGWYGQGTYFADDVSLVGPGGQTQVPPVPSGLS
VSGTTSSSVSLAWNASTGATGYNVYRGGAKIASVTGTSYTNTGLSPSTSYSYTVTATNSA
GESAQSGAVTGTTTAGGTQVPPTPSGLSVSGTTSSSVSLAWNASSGATGYNVYRGGSKIA
SVTGTSYTNTGLSASTTYSYTVSATNSAGESGQSSAVSATTAGTGGGNGSLPKHVLTGYW
QDFVNSAKPLSLAAVPAGYNLVAVAFANADPSHPGGVTFSVDSGLSSALGGYTDAQFKAD
IATLHSRGQKVIVSVGGQNGAISVGDSTSANNFATSVYSIMQSYGFDGVDIDLENGVNAT
YMAQALQSLSGKAGSGLIITMAPQTIDMQSTGMAYFQLALNIKNILTISNMQYYNSGSMN
GCDQGVYSEGTENFMTALACIQLQGGLRPDQVGLGLPASGSAAGGGYVSPSLVNNALDCL
AAKTSCGSFVPPSTWPAIRGAMTWSINWDASNGYSFVNTVAPHLAAMP
Download sequence
Identical sequences C7QF90
479433.Caci_5990 gi|256395125|ref|YP_003116689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]