SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7RJ57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7RJ57
Domain Number 1 Region: 22-382
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 5.75e-74
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7RJ57
Sequence length 387
Comment (tr|C7RJ57|C7RJ57_ACCPU) Cytochrome d1 heme region {ECO:0000313|EMBL:ACV36668.1} KW=Complete proteome; Reference proteome OX=522306 OS=Accumulibacter phosphatis (strain UW-1). GN=CAP2UW1_3408 OC=Candidatus Accumulibacter.
Sequence
MNRLFALLWIALLTGCAAPPLRGTGDLGLVIERASGQVTLVDTSRREPYARIGGFGDLSH
ASVVYSRDGRYAYVFGRDGGLTKVDMLTARIVRRVLQSGNAIGGSISQDGRIVVAQNYTP
GGIKAFDAETLELLSEVPAEYAPGSFSKVVGLADLSGNRFAYALFDGGEIWVSDFSDPRR
PRTQRYPAGLQPYDGLVTPDGRYYLAGLFGEDGVALLDTWQPEQGSRRILANYGRGQEKL
PVFKMPHLRGWSLAQGNAYLPAIGRHEVLVVSGSNWREVGRIKVKGQPVFVIARPDGRQV
WVNYAFPDNGWVEVIDTLTGQVVRTLEPGKAILHMEFTPRGEQVWISARDDDKVLIYDTA
TFARIGEFTAQAPSGIFFTSRAGRTGF
Download sequence
Identical sequences C7RJ57
gi|257094956|ref|YP_003168597.1| 2000176560 522306.CAP2UW1_3408 WP_015767841.1.47741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]