SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8VYB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8VYB9
Domain Number 1 Region: 17-325
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.57e-37
Family Quinoprotein alcohol dehydrogenase-like 0.0011
Further Details:      
 
Domain Number 2 Region: 381-633
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.76e-28
Family Quinoprotein alcohol dehydrogenase-like 0.0023
Further Details:      
 
Domain Number 3 Region: 646-771
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000942
Family Quinoprotein alcohol dehydrogenase-like 0.0055
Further Details:      
 
Domain Number 4 Region: 782-832
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000981
Family Type I dockerin domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C8VYB9
Sequence length 834
Comment (tr|C8VYB9|C8VYB9_DESAS) Pyrrolo-quinoline quinone {ECO:0000313|EMBL:ACV62800.1} KW=Complete proteome; Reference proteome OX=485916 OS=B-1644). GN=Dtox_1964 OC=Desulfotomaculum.
Sequence
MQFQGNEQRVGQIDVTSPVLTPRLAWSKYVSNQGGTGVENTAVIDGDFVYVFACNKLLAL
SRTTGDTLWEQNLGDHGPLQISTPACGGGKIFLATFNGYVMAFDAKEGERLWSSKISQRG
FQCPVTYADGFIYVGDGGTGGETNSYYCLDESGKLCWTYTSSTGGYLWCGCSVIDNYVVF
GNLEGVVTSVYRDTGSVSDRVYLSDAARLSFARAIPGRIRSSVAYRDGYIYTSSENSNTE
GYLWKIGFDQGSGQFINDGFSTATGFSTSTPVVYDGRVYVGQGEHGCAGSLVCVDDTGGE
ILWSYPVESGVKSSPALMVNEGGVYIYVTTATPDGYLYCLSGDGKLVWKYNLPDAGYVMQ
GPAVADGCLYQGTSGGYLYCLQEEREWPCFQGDTVNSGIASGSAPVQSPGVDWQAFTHYR
ATHGIDHPAMLANGKVFVVDAEDYAWAFDQATGQTLWSTQLDETPVRFNMPTPAYGEGKV
FVATCQGCIYALDENSGQILWSGKLTHGSYQNEELSTQVLYSEGKVYVGSYEGNYYCLDA
SGQDGNPRIIWKYSGNANYQWWSGAAVAGDYLLFGDAKSVVAAVYKNTGVKAGEVNLSGS
YGISAGQICSAVNFNWLQKKIYLTSNKGYVWCLGFDPLTGKFDTGTGWYKSIGNSSNSTP
SVYDGKVYACSGSFNKPGGLYCLSAADGSLLWQHDFGSYGTEASPVIAVQNGKPYIYIST
DCLTASAYCFDEQGNILWDFCPDHTEYTLAGVSIAGGRVFFVNDAGYVYALREQSEADLS
CDLNGDSKVDVMDLILVGQHFGETGTPAWCNEDINKDGNVDMLDMVLIGQHWTA
Download sequence
Identical sequences C8VYB9
gi|258515201|ref|YP_003191423.1| 485916.Dtox_1964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]