SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8VYD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8VYD3
Domain Number 1 Region: 307-411
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000401
Family Ngr ectodomain-like 0.038
Further Details:      
 
Domain Number 2 Region: 1977-2028
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000373
Family Type I dockerin domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C8VYD3
Sequence length 2031
Comment (tr|C8VYD3|C8VYD3_DESAS) Uncharacterized protein {ECO:0000313|EMBL:ACV62814.1} KW=Complete proteome; Reference proteome OX=485916 OS=B-1644). GN=Dtox_1979 OC=Desulfotomaculum.
Sequence
MSRLLTGQSGRNVKKGISLLLALVMLLSLLPVQVIASEGEPELTATGINLSEGVIAGQPA
SVTAGVYNTGNANEDEFSGVLHIAEQETPYEEQTDSTDAISETGENNNEQNIAANVLKES
GTEALELVSLSPANGATGVAVDAPLTLTFNRPVEANPDYSSGYLGIKVAIIQESDGDWYG
GEANVLKFSTENPEQVTVDIADSAPYGGELKPGESYTVYIDNDCIRAKDTGETFKGIMGG
AMDPDTDICWSFRTGEALSARINGGEAVGGNSLQAIVEAAEISPAEVTSVEVTRGAVSAD
DLAYIESSLINLETLTASYTVNINDGVLPAEAFIMHAALRTVNLPSVVSIGENAFGYCGN
LKTVRLNNLRSMGDYAFTCCSSLDTLVVPNLQDVSDSAFSLCLSLEYVYMPKAVSMSGMT
GFVLSGSLAGAWFPKLGNIAPYAFEGDTSFREMYLETAPFHYSEGLGGAFLDLPADRIVY
VPEDYVAAYLGYADDDPEDGKWYGWTVKSFAESSTLGAFVEVLINQLPENDRLTYGDIPQ
VQSLRAAYNRLTAVQRESVSGAVYEKLTAAEATLLGQGNTIVEGIINRIDALPSTVTMED
KAEIRSIRQAYDNLPEMYRELITNLTALIAAEEVIAELDIKDVEQLIERLPSADELTLAN
EADVQAARSAYDALIAGQQASVSNYNVLLAAEDAIARLGFKSVEQLIEQLPSPDDLTLDN
KSAVQAARNAYDALSAEQRVAVGNYELLQAAEAKIYDLEAQEAARAVDSLIDELPSAQEA
QIADKTAALGARAAYNALNDQAKTYVAALQKLTDVLEAISGLERQTLKGGAVNDRISALP
AVEALTLTDKAAVLEIRADYDALTEQEKALVTADNLSKLQEAEAKIARLESENPASSVTV
TIEKFTLGQGFVRKPVQVSINAGENGAAVVTRLLGMGNYTNTGSIDSAFYLASIKDNGSA
QADIPAYIIDAITAGEGTVGTRANANYLGEFDYYHTSGWMYTVNNILPNYGLSDYIPQDG
DVFRLQFTLYGYGGDLGFGDNKLIDTADKGALIKKLAAIDASEDRLTMLADPVYKGYYDK
ALLVLQNLQASQIQVDAALADLNTAPNPPSSLGKVTVTVRDVVDRKWTTWNYHGGETTVE
QLSGLGDYQESFGVLLEDVEVSITPGMTVRQAVAAALRSRGYQVTGTPTYIKGIGPVTSD
DYTRTVAHLSENDAGSRSKWVMSQNDWCIWDTSQAYPVEDGDVLKLEYSVDGGIDIHCHP
GSGSYLTVNFTIDGTTYDVSSSAGYYMVPAGTEEITVSAERLLRYAGKDIDRYLVVELQS
EGVSVLNKPATFAVSDGQVIKAIIDDRYNSPNTDTNSGKTYTYTIEIKRTPAQVDAMIAA
IPGLENIVYADKAQIEKVRRCYNYLTVGEKTGVAGLAVLEAAEARITAIYDVNRAEANRV
IDLIKVLPNTMKNEVVTLEHRAAIEYARAQYEALTEDQKVLCSSWLGYMERAEAALAELL
DAQQAVEGVPKDYSKDFLLSTMALNLSVGEEEEMVMFDTPRVGSDNCAYNLDDLILEYSG
QEGVFEIEKRVVNKDGQDLTKYYVKGLSDGVGYFTVKYLGYSGQIPVIPVCVQASGSRSP
ALSTDIDEQVSKYDTMYFTEEEGSYPFTFTAESEDGASVSAMVYGVMYEPNAGGVFTVPL
RDRYNPIIVTAAKDGQTTSIAYGIRAKVIALKITNESRGGNVFYQGDTVSIGCTGVMLPV
PKVSRIYNPASSRLEYHTDMPRYDLVGSSSSQYAAGALTFELTGYGDIALTGGHVHLSWF
GSGLYAETPIGGAPPNLNADQIANNFSSLPDIRLTVIRDPYYAPEDVLSAGMVGASTIHA
GDEVTVSIPGIDTDMLKKNHTTNSGEIVDLLDSYTVFATDIPGLKQVKSVNVKTTDQLKN
LKTITFTVPENTPSGDYKLKGGYIWVKYGPTWWTHEKEYYVTKMEDVDLTVTGETGAGDV
NQDGKVDVQDMILVGQHFNERGAAGWISEDINKDGEIDVLDMIFIGQHWKD
Download sequence
Identical sequences C8VYD3
WP_015757519.1.30109 485916.Dtox_1979 gi|258515215|ref|YP_003191437.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]