SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8VZE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8VZE8
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 7.32e-23
Family N-utilization substance G protein NusG, N-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 110-163
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000201
Family N-utilization substance G protein NusG, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C8VZE8
Sequence length 164
Comment (tr|C8VZE8|C8VZE8_DESAS) Transcription termination/antitermination protein NusG {ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome; Reference proteome OX=485916 OS=B-1644). GN=Dtox_4226 OC=Desulfotomaculum.
Sequence
MHWYVIHCLTGHEEDVRSRVKEKDIARAVVPRRLMVERRQGGWQYVERVVFPGYVFVQAH
MTPAAYYAMRNLPGVIRVLGTSRPVPLMGNEVTLFLKLCRDGDPLGLSEVFVKGGSVKVI
SGPLMGLEGHIVKLDARRFRAKVNISLMGEPRIVELAVSVIKKT
Download sequence
Identical sequences C8VZE8
gi|258517294|ref|YP_003193516.1| WP_015759563.1.30109 485916.Dtox_4226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]