SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8WH88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8WH88
Domain Number 1 Region: 59-242
Classification Level Classification E-value
Superfamily Sortase 3.79e-25
Family Sortase 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C8WH88
Sequence length 246
Comment (tr|C8WH88|C8WH88_EGGLE) Peptidase C60 sortase A and B {ECO:0000313|EMBL:ACV55479.1} KW=Complete proteome; Reference proteome OX=479437 OS=NCTC 11813 / VPI 0255) (Eubacterium lentum). GN=Elen_1511 OC=Eggerthellaceae; Eggerthella.
Sequence
MSTNIKQRFAIMVAVTALVGAAALGLWLFSIHDRAADVDPSPILADASGSDAASDGAPTV
DWEFWLSVNPDIVAWVSVPGTDIDYPVVQASADDPTFYLDHDVYRGWNPYGCPYLDAGCA
GRGIDSPLALMFGHHMNDGSMFSAFANYSDRGFAQEHQEILLQTPERDIRLNVIAADVVD
SNAEHKRLEFADDGELGFWLERLLAEADVVLDVDVEADSVKAFCTCSYGRWNGHERTIVY
AREEVV
Download sequence
Identical sequences C8WH88
gi|257791262|ref|YP_003181868.1| WP_015760608.1.14381 WP_015760608.1.89587 479437.Elen_1511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]