SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8X8S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8X8S6
Domain Number 1 Region: 2-252
Classification Level Classification E-value
Superfamily Cgl1923-like 1.7e-86
Family Cgl1923-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C8X8S6
Sequence length 286
Comment (tr|C8X8S6|C8X8S6_NAKMY) Uncharacterized protein {ECO:0000313|EMBL:ACV79131.1} KW=Complete proteome; Reference proteome OX=479431 OS=/ JCM 9543 / NBRC 105858 / Y-104) (Microsphaera multipartita). GN=Namu_2785 OC=Nakamurella.
Sequence
MSEFMPLRNPVMIAAFEGWNDAGDAASAAVEQLGLIWDAVPLTELDPEGFYDFQVTRPTV
RLVDGVTRTIEWPTTRLSVCRLPDSPSDVILVHGIEPNFRWRAFCDELLKIAVDHQVSKV
IGLGALLADVPHTRPIQVTGSAHDEQTAVSLGLTRSRYEGPTGISGVFQDACVQAGIPAL
SFWASVPHYVSQAPSPKATLALLHRVEEVLDVAVPLGNLPAQADEWEAEVSQIASEDEEI
SEYIRSLEEREEQDEPLKPASGESIAAEFERYLRRRGPKPGGDSWR
Download sequence
Identical sequences C8X8S6
gi|258652964|ref|YP_003202120.1| WP_015748010.1.85990 479431.Namu_2785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]