SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8Z5M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8Z5M2
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-41
Family TFIIH domain 0.000000971
Further Details:      
 
Domain Number 2 Region: 173-217
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000000154
Family BSD domain 0.0059
Further Details:      
 
Domain Number 3 Region: 244-289
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000301
Family BSD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C8Z5M2
Sequence length 642
Comment (tr|C8Z5M2|C8Z5M2_YEAS8) Tfb1p {ECO:0000313|EMBL:CAY78811.1} KW=Complete proteome OX=643680 OS=(Baker's yeast). GN=EC1118_1D0_5952g OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMML
RLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDADIYEEK
RRREESAQHTETPMSSSSVTAGTPTPHLDTPQLNNGAPLINTAKLDDSLSKEKLLTNLKL
QQSLLKGNKVLMKVFQETVINAGLPPSEFWSTRIPLLRAFALSTSQKVGPYNVLSTIKPV
ASSENKVNVNLSREKILNIFENYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKLRGEK
IMQNDRGDVIIDRYLTLDQEFDRKDDDMLLHPVKKIIDLDGNIQDDPVVRGNRPDFTMQP
GVDINGNSDGTVDILKGMNRLSEKMIMALKNEYSRTNLQNKSNITNDEEDEDNDERNELK
IDDLNESYKTNYAIIHLKRNAHEKTTDNDAKSSADSIKNADLKVSNQQMLQQLSLVMDNL
INKLDLNQVVPNNEVSNKINKRVITAIKINAKQAKHNNVNSALGSFVDNTSQANELEVKS
TLPIDLLESCRMLHTTCCEFLKHFYIHFQSGEQKQASTVKKLYNHLKDCIEKLNELFQDV
LNGDGESMSNTCTAYLKPVLNSITLATHKYDEYFNEYNNNSN
Download sequence
Identical sequences A0A0L8VTG8 A0A250W8E9 A6ZYQ9 B3LFY5 B5VGJ1 C7GQW1 C8Z5M2 E7LSS9 G2WB49 H0GED9 N1P6V8 P32776
SCRT_00219 YDR311W YDR311W YDR311W NP_010597.3.97178 tr|A6ZYQ9|A6ZYQ9_YEAS7 YDR311W YDR311W YDR311W YDR311W YDR311W YDR311W IGBMC-0033-000 YDR311W YDR311W YDR311W YDR311W YDR311W YDR311W 4932.YDR311W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]