SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8ZH31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8ZH31
Domain Number 1 Region: 17-227
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.39e-38
Family Phosducin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C8ZH31
Sequence length 286
Comment (tr|C8ZH31|C8ZH31_YEAS8) Plp2p {ECO:0000313|EMBL:CAY86560.1} KW=Complete proteome OX=643680 OS=(Baker's yeast). GN=EC1118_1O4_5127g OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MQNEPMFQVQVDESEDSEWNDILRAKGVIPERAPSPTAKLEEALEEAIAKQHENRLEDKD
LSDLEELEDDEDEDFLEAYKIKRLNEIRKLQERSKFGEVFHINKPEYNKEVTLASQGKKY
EGTQTNDNGEEDEGGVYVFVHLSLQSKLQSRVLSHLFQSAACKFREIKFVEIPANRAIEN
YPESNCPTLIVYYRGEVIKNMITLLELGGNNSKMEDFEDFMVKVGAVAEGDNRLIMNRDD
EESREERKLHYGEKKSIRSGIRGKFNVGIGGNDDGNINDDDDGFFD
Download sequence
Identical sequences A0A0L8VGZ1 C8ZH31 E7KUM2 H0GNY5
YOR281C YOR281C YOR281C YOR281C YOR281C YOR281C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]