SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8ZHN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C8ZHN8
Domain Number - Region: 855-895
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0701
Family UBX domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C8ZHN8
Sequence length 1176
Comment (tr|C8ZHN8|C8ZHN8_YEAS8) Avo1p {ECO:0000313|EMBL:CAY86213.1} KW=Complete proteome OX=643680 OS=(Baker's yeast). GN=EC1118_1O4_0969g OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MDTVTVLNELRAQFLRVCPEKDQMKRIIKPYIPVDEFNTEQCLDSSIRELYMNSDGVSLL
PELESPPVSKDFMENYASLGKMRIMRENEGQKGKANQNLIGAEKTERDEEETRNLQDKSA
KNTLIVEENGTLRYNPLNSSASNSLLNDDDHTSGKHHKTSSKEDSYLNSSMEMQKKSSKR
SSLPFVRIFKSRRDHSNTSGNKNVMNTTNTRAKSSTLHPPGARHNKKGSKFDMNFDFDEN
LEEEDDDDDDDEEGDDIHSQFFQLDDDFDAKGSGASPAHKGINGMSNNKNNTYTNNRNSI
SILDDRESSNGNIGSASRLKSHFPTSQKGKIFLTDNKNDGQKSDSLNANKGIHGDGSSAS
GNGSVSRDGLTETESNNISDMESYINEKDLDDLNFDTVTSNINKTVSDLGGHESTNDGTA
VTNRDSKDSRSNSNEFNAQNRDRITPGSSYGKSLLGSEYSEERYSNNDSSTMESGEMSLD
SDMQTNTIPSHSIPMSMQKYGIYHGDDDSTLNNVFDKAVLTMNSSRHPKERRDTVISGKE
PTSLTSSNRKFSVSSNLTSTRSPLLRGHGRTSSTASSEHMKAPKVSDSVLHRARKSTLTL
KQDHSQPSVPSSVHKSSKEGNILIEKTTDYLVSKPKASQLSNMFNKKKKRTNTNSVDVLE
YFSFVCGDKVPNYESMGLEIYIQASKKYKRNSFTTKVRKSSTVFEVIGFALFLYSTEKKP
DNFEEDGLTVEDISNPNNFSLKIVDEDGEPFEDNFGKLDRKSTIQSISDSEVVLCKVDDA
EKSQNEIETPLPFETGGGLMDASTLDANSSHDTTDGTINQLSFYKPIIGNEDDIDKTNGS
KIIDVTVYLYPNVNPKFNYTTISVLVTSHINDILVKYCKMKNMDPNEYALKVLGKNYILD
LNDTVLRLDGINKVELISKKDARELHLEKMKPDLKKPVLPTIQSNDLTPLTLEPLNSYLK
ADAGGAVAAIPENTKVTSKAKKISTKYKLGLAKQHSSSSVASGSVSTAGGLANGNGFFKN
KNSSKSSLHGTLQFHNINRSQSTMEHTPDTPNGVGDNFQDLFTGAYHKYKVWRRQQMSFI
NKHERTLAIDGDYIYIVPPEGRIHWHDNVKTKSLHISQVVLVKKSKRVPEHFKIFVRREG
QDDIKRYYFEAVSGQECTEIVTRLQNLLSAYRMNHK
Download sequence
Identical sequences C8ZHN8
YOL078W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]