SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8ZIY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8ZIY1
Domain Number 1 Region: 254-415
Classification Level Classification E-value
Superfamily eEF1-gamma domain 2.75e-66
Family eEF1-gamma domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 77-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.66e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.00000022
Further Details:      
 
Domain Number 3 Region: 1-73
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000536
Family Glutathione S-transferase (GST), N-terminal domain 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C8ZIY1
Sequence length 415
Comment (tr|C8ZIY1|C8ZIY1_YEAS8) Cam1p {ECO:0000313|EMBL:CAY86912.1} KW=Complete proteome OX=643680 OS=(Baker's yeast). GN=EC1118_1P2_2575g OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSQGTLYANFRIRTWVPRGLVKALKLDVKVVTPDAAAEQFARDFPLKKVPAFVGPKGYKL
TEAMAINYYLVKLSQDDKMKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKG
GAPYNKKSVDSAMDAVDKIVDIFENRLKNYTYLATENISLADLVAASIFTRYFESLFGTE
WRAQHPAIVRWFNTVRASPFLKDEYKDFKFADKPLSPPQKKKEKKAPAAAPAASKKKEEA
KPAATETETSSKKPKHPLELLGKSTFVLDDWKRKYSNEDTRPVALPWFWEHYNPEEYSLW
KVTYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDY
VPAFDVAPDWESYDYAKLDPTNDDDKEFINNMWAWDKPVSVNGEPKEIVDGKVLK
Download sequence
Identical sequences A0A0L8VFU5 A6ZWK0 B3LL19 B5VTB2 C7GU06 C8ZIY1 E7KJ91 E7KVP0 E7M1I3 E7QLG9 G2WPD0 H0GPQ8 N1NW49 P29547
YPL048W YPL048W YPL048W YPL048W 4932.YPL048W YPL048W YPL048W YPL048W YPL048W SCRT_02444 YPL048W YPL048W NP_015277.1.97178 YPL048W tr|A6ZWK0|A6ZWK0_YEAS7 YPL048W YPL048W YPL048W YPL048W YPL048W YPL048W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]