SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9ELL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9ELL9
Domain Number 1 Region: 10-294
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.19e-63
Family Haloalkane dehalogenase 0.000000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9ELL9
Sequence length 296
Comment (tr|C9ELL9|C9ELL9_9SPHN) Haloalkane dehalogenase {ECO:0000256|HAMAP-Rule:MF_01231} OX=675435 OS=Sphingomonas sp. HZ-1. GN=dhaA OC=Sphingomonadaceae; Sphingomonas.
Sequence
MSLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIA
CDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARR
HRERVQGIAYMEAITMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILR
PLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLF
INAEPGHLTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPEEIGAAIAAFVRRLRPA
Download sequence
Identical sequences C9ELL9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]