SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9J1R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9J1R4
Domain Number 1 Region: 25-123
Classification Level Classification E-value
Superfamily Rhomboid-like 1.83e-19
Family Rhomboid-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C9J1R4
Sequence length 134
Comment (tr|C9J1R4|C9J1R4_HUMAN) Rhomboid-related protein 4 {ECO:0000313|Ensembl:ENSP00000400765} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RHBDD1 OC=Catarrhini; Hominidae; Homo.
Sequence
MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCY
QQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYL
LLQFAVAEFMDEPD
Download sequence
Identical sequences C9J1R4
ENSP00000400765 ENSP00000400765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]