SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9J3W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9J3W8
Domain Number 1 Region: 81-184
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000309
Family I set domains 0.00000221
Further Details:      
 
Domain Number 2 Region: 7-65
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000369
Family I set domains 0.0000507
Further Details:      
 
Domain Number 3 Region: 236-297
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000128
Family Toll/Interleukin receptor TIR domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9J3W8
Sequence length 298
Comment (tr|C9J3W8|C9J3W8_HUMAN) Interleukin-1 receptor type 1 {ECO:0000313|Ensembl:ENSP00000410461} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IL1R1 OC=Catarrhini; Hominidae; Homo.
Sequence
MEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLG
KQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNG
SVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAY
IQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKT
YDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCGYKLFIYGRDDYVGEDIVEVINE
Download sequence
Identical sequences C9J3W8
ENSP00000410461 ENSP00000410461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]