SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9J7Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9J7Q4
Domain Number 1 Region: 54-154
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.95e-29
Family Epoxide hydrolase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9J7Q4
Sequence length 159
Comment (tr|C9J7Q4|C9J7Q4_HUMAN) Protein ABHD11 {ECO:0000313|Ensembl:ENSP00000397666} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ABHD11 OC=Catarrhini; Hominidae; Homo.
Sequence
MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLL
DGEAALPAVVFLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMS
QDLQDLLPQLGLVPCVVVGHSMGGKTAMLLALQRSQPPP
Download sequence
Identical sequences A0A2I2YG87 A0A2I3RHC3 A0A2J8XUX8 C9J7Q4
ENSP00000397666 ENSP00000460693 ENSP00000397666 NP_001287987.1.87134 NP_001287987.1.92137 XP_008966772.1.60992 XP_009451598.1.37143 XP_016800780.1.37143 XP_018887357.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]