SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9JF16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C9JF16
Domain Number - Region: 9-66
Classification Level Classification E-value
Superfamily Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin 0.0332
Family Proteinase/alpha-amylase inhibitors 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9JF16
Sequence length 67
Comment (tr|C9JF16|C9JF16_HUMAN) KAT8 regulatory NSL complex subunit 3 {ECO:0000313|Ensembl:ENSP00000415236} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KANSL3 OC=Catarrhini; Hominidae; Homo.
Sequence
MPLYDNQKARSVMNECERHVIFARTDADAPPPPEDWEEHVNRLVMSQCCAVLLWTSVQGE
CGRLWQV
Download sequence
Identical sequences A0A2J8PXW5 C9JF16
ENSP00000415236 ENSP00000415236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]