SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9LY75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9LY75
Domain Number 1 Region: 13-246
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.47e-33
Family Carboxylesterase/lipase 0.0000998
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9LY75
Sequence length 249
Comment (tr|C9LY75|C9LY75_SELS3) Thermostable monoacylglycerol lipase {ECO:0000313|EMBL:EEX76269.1} KW=Complete proteome; Reference proteome OX=546271 OS=Selenomonas sputigena (strain ATCC 35185 / DSM 20758 / VPI D19B-28). GN=Selsp_0279 OC=Selenomonadaceae; Selenomonas.
Sequence
MIIEGAEPFLLPGGPHGVLLLHGFTGMPPEMRLLAEALYRAGHTVLCPRLAGHGTSPEDL
AHTDAEDWYDSALDGYAILSGLVPRISVVGHSMGALLALRLAAQKRVTGVVTLAAPIFID
EGRGMKHLPPRSACIGRFHPKLRKSLRDVPEFCNVTYDRMPLVAIHELVGFIEHVKALLP
KVYAPLLLVHSLHDRTAHRRSLRYIYDHVGAAHKEVLWLVRSGHLVMLDAERRAVFRRTA
SFLREMGSV
Download sequence
Identical sequences C9LY75
gi|330838135|ref|YP_004412715.1| WP_006193799.1.43677 WP_006193799.1.73955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]