SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9S775 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9S775
Domain Number 1 Region: 330-381,411-470
Classification Level Classification E-value
Superfamily PH domain-like 5.33e-18
Family Ran-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9S775
Sequence length 491
Comment (tr|C9S775|C9S775_VERA1) Uncharacterized protein {ECO:0000313|EMBL:EEY14660.1} KW=Complete proteome; Reference proteome OX=526221 OS=(Verticillium wilt of alfalfa) (Verticillium albo-atrum). GN=VDBG_00768 OC=Plectosphaerellaceae; Verticillium.
Sequence
MADEPQSGSPRSDPVDSKEDAETAAARKELRHAAISENTVADSVGQTGRTTPEDDQEDDL
KDRISSPKKKRARDQLDDVEAEELDTHSVASTDSAKDRALRSEPEKKRHRDEVADETVKT
TADAEKGSDTVENEATTEKATVDVSDQKDPKTKTLPVSEKEKTTSSSAFASSGFAKLASS
SASPFGALGGGSAKKSVFGGSAAAASPFASASPQKPATTAATPTLSFGSTGEPAAASPFA
SAAPGANGFKSVFGGGGGFGSALAGNPLTSFAKPGASFKSEKPAKPFGAPESDAEDEDGD
EDGDEEPESAADDKDAKEDSDKEDAKVSEEKKKSRLQRVAVDDGEAGEITVLAVRSKIYH
LVKEEGWKERGAGMLKINVPESCVSFDDDGVPIPGSFDASGLEDDEEAAAGSKTVRLVMR
QDSTHRILLNTTVFPALDFQEKASLKAVGVCFTAFEGEDAKPVTVQAKMSIANAKNFMSE
IGLIQRELASA
Download sequence
Identical sequences C9S775
VDBG_00768T0 XP_003009086.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]