SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9SCC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9SCC5
Domain Number 1 Region: 92-338
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-35
Family SSRP1-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9SCC5
Sequence length 433
Comment (tr|C9SCC5|C9SCC5_VERA1) Histone chaperone Rttp106-like protein {ECO:0000313|EMBL:EEY16740.1} KW=Complete proteome; Reference proteome OX=526221 OS=(Verticillium wilt of alfalfa) (Verticillium albo-atrum). GN=VDBG_02849 OC=Plectosphaerellaceae; Verticillium.
Sequence
MAPGLDIQRLGVVFQSRPDILEGIQREANSASRVTLFNDIASFVYEQTNGPEPAAKRRRV
DVDASNGFKASNGNGTINVAGSVPASAAEAAVDEPVQLEIKEISVSVPQRKKFELCFTEN
HLYARVPGTTAPAAGIAYAWGDIEYAFYLPIPEKTQVQHNYIIFPRGSCLPSKTETTIPT
AEPLVFTVPATAPKQGTILGPKASSAAAVSDTYRSLFDWALTTHLRAASNPINIVSADPA
KFHSMVRQPHRPNEKAVHVKAFRGSKDGYLFFLPTGILWGFKKPLLFIPLERISSLSYTS
VLQRTFNIVVEAFTGEGDATEELEFAMLDQEDYQGIDESYAGKKAAGAGDVAPDASADTD
GRTELEKAQAEAELQLQDEEDEDEEDYDPGSEGESEGSGVSSDEDDEDDDQEMEDGEDDE
GDDAGDESTNVKG
Download sequence
Identical sequences C9SCC5
VDBG_02849T0 XP_003006710.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]