SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9SHQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9SHQ3
Domain Number 1 Region: 281-520,625-640
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-59
Family BAR domain 0.014
Further Details:      
 
Domain Number 2 Region: 814-931
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.79e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.00028
Further Details:      
 
Domain Number 3 Region: 630-753
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-21
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C9SHQ3
Sequence length 1092
Comment (tr|C9SHQ3|C9SHQ3_VERA1) Csx2 {ECO:0000313|EMBL:EEY18476.1} KW=Complete proteome; Reference proteome OX=526221 OS=(Verticillium wilt of alfalfa) (Verticillium albo-atrum). GN=VDBG_04585 OC=Plectosphaerellaceae; Verticillium.
Sequence
MGIVSSRPDDGASLYLRDQNRLSISSIVVTNPRTRNTVNIAPNAFPASRIVASRPAGEST
PIEFVQDLESAVPGGAPNFILKLSSDEELVFTFTFVIRQSEAGVAQPTNGVAEVHPPVDT
QITGLTYVYASSPREVENLVTREFHADPNLHKNANVELVGDFTTGGSPSVAFDWTWKWKP
PKNTEDRGGGWRNSCSFSYWVSNTTTPLSTPTLISAFSPGAASQARVASSQSVESRISHA
DLEEPASPLYSVPTTIQTPLPHQLPPQPEPVKVDVVCPKPGDDMTVTDDGPVFRATIKAL
EQKTGNMRMQVKRVLKKAESAYEAQTDANDKFASFLEALKEASATNANAVQPAIDHYFDK
IAQEIMAYERRNTLNLQKIVIEPLSKVYTFDIKRAEDKKRDFEEESKDYYAYLARYLGQR
HDSVKAKKLAESDTKYQTKRRTFELKRFDYSSFMQDLHGGRKEQEVLSHLTRYADAQARG
FLGAARKIDTLLPQLEALSNEVSEADKEFQYQRREREEKRRLLEKSNADTDLPPAAANNA
YSTSSNGQATSTSDSELGRADSTGSQLKSAISGGSQGAVASPELSRSPGSLGQSSIGSPA
AASKFKGIRDLEERDHVQIANAERHNAQRKEGLLWALSRPTSHVDPRNLNKPGWHKFWIV
LDQGKLSEYSNWKQRLDLHMDPIDLRMASVREARNAERRFCFEVITPHNKRVYQATSEED
MNSWILSINNALQSAVEGRMGDRSGPAPSSSDSSSFKRDIGSILTGKSPSLGHGSYNPNA
NSNSGMPARRITVGAKPSIPRAPSGSYDDTPDKLLQMLRDNDQGNCWCSDCGSGAKVEWV
SINLAIILCIECSGIHRSLGTHISKVRSLTLDITSFTADIVELLMLVGNRVANMIWEAKL
DASIKPGPQATREQRLRFITAKYVDRAYVEPISTTLSRYSTPDETLLAGIKKNEVQQVIY
AMALKANPNATDKSRGTHAVFLALAAADPASPSAVGGQQPEPEKPVPFPVAEMLVQNGAE
IPTTMPAFPLSRSAQLYVEQKRGRSVGISRDGIGSLRPSQNAGDKIQQDMESRLHKRMSA
GGRLAKSPIPER
Download sequence
Identical sequences C9SHQ3
VDBG_04585T0 XP_003004979.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]