SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9SR89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9SR89
Domain Number 1 Region: 30-157
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-24
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 293-401
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-23
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9SR89
Sequence length 422
Comment (tr|C9SR89|C9SR89_VERA1) PH domain-containing protein {ECO:0000313|EMBL:EEY20891.1} KW=Complete proteome; Reference proteome OX=526221 OS=(Verticillium wilt of alfalfa) (Verticillium albo-atrum). GN=VDBG_07001 OC=Plectosphaerellaceae; Verticillium.
Sequence
MAAVSQQLRPVLPERGTTIAIPTTAPPALISSDANQTRLRSQSMLDTYASPVNQNGSFEF
DREVKSGHVQKRTQKTKTWKSIYLVLRPNALSLYKTDKEDKLRHKINLSDLTAVALLRDP
KQKRKHVFGCFSPAKNYHFQAKDDNDAQQWVDLIRTYARIDEEEEELLLASPVAQRGSYL
PPISNGSYTDPALRERVTFSSPEPLDPPAPRFMSTDKRRPSNMLDSSGYSGNELASHSDF
SDTEMQRLRGMSIEDLAGQSPQDSGVLSDSGLPDRPQMKHRNSSQVSGLNLEHDPDRVIW
QGWLWFLRNKGGVRQWKRQWAVLRPRNFILYKDESEYTAQFLRPMSAVVDVVDIDPVSKT
KSHCLQLITDEKSYRFCAPDEESLVLCLGAFKSLLAKRRELEARAAANASHATAIPAPVS
TV
Download sequence
Identical sequences C9SR89
VDBG_07001T0 XP_003002430.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]