SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9SSF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9SSF1
Domain Number 1 Region: 97-237
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-47
Family Ran-binding domain 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C9SSF1
Sequence length 257
Comment (tr|C9SSF1|C9SSF1_VERA1) Ran-specific GTPase-activating protein {ECO:0000313|EMBL:EEY21716.1} KW=Complete proteome; Reference proteome OX=526221 OS=(Verticillium wilt of alfalfa) (Verticillium albo-atrum). GN=VDBG_07826 OC=Plectosphaerellaceae; Verticillium.
Sequence
MSAPEATEPKVEEPKIEAPKAEEAPATGTADAPATESTGEADKPVTAQSSVFSMFGGGAK
KEKKPEDEDRGDNSGSNKAQREAAAAAADDDQAPESEDVHFEPVHKLTEKVETATNEESE
QQLFKMRAKLFKFIKESSEWKERGTGDVRLLKHKENGKTRLVMRRDKTLKVCANHYIVPE
MKLSPNVGSDRSWVWNAAADVSEGEPEAATLAIRFANSENANLFKDAFLQAQKDNEALFK
KAEDGEASTETPAAEQS
Download sequence
Identical sequences C9SSF1
VDBG_07826T0 XP_003002367.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]