SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9YSS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9YSS1
Domain Number 1 Region: 35-325
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.51e-84
Family Amylase, catalytic domain 0.00000065
Further Details:      
 
Domain Number 2 Region: 419-545
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.69e-37
Family Ricin B-like 0.0000328
Further Details:      
 
Domain Number 3 Region: 327-412
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.13e-19
Family alpha-Amylases, C-terminal beta-sheet domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9YSS1
Sequence length 548
Comment (tr|C9YSS1|C9YSS1_STRSW) Melibiase {ECO:0000256|RuleBase:RU361168} KW=Complete proteome; Reference proteome OX=680198 OS=Streptomyces scabiei (strain 87.22). GN=SCAB_3891 OC=Streptomyces.
Sequence
MVPLHKRLLRLLTATALTFAACVTASAGTSAEAAPGSPALTPPLGWNSWNSFGCGITEAQ
VRQATDAMVSSGMREAGYRYVVVDDCWFDPQRDAAGNLRANPTKFPSGMKALGDYIHGKG
LKFGIYQAPNEKTCAQGVGTYPGSTGSKGHEAQDAAIFASWGVDYLKYDWCSGSGTLDQQ
IAQFTVMRDALRATGRPIVYSINPNSFHAPTGHTYDWGQVADLWRTTEDLLDIWQNGNTN
SYPMGVGNVLDITAPLAAQSGPGHWNDPDMLVVGRPGLSLTESRSHFALWSLLSAPLMAG
NDIRTMSADVSAVLRNPRLLAVNQDSLGAGGRRVRDDGDTEVFAKPLSDGSVAVGLLNRG
GSATTVTATAAQVGLTGGPFTLTDLWTGGTSSTSGQISASVPAHGVAVFKMTGGSPVTST
TARLRGTGSGRCLAVDRSSTAAGSAAVIWDCRTSADQQWTTWAGGEIRVYGDKCLDAYNQ
GTANNTRVIVWQCNGQNNQKWTPQADGSIRNVHAGLCLDAQQGATANGTPAVLWTCNGQN
NQRWTTLR
Download sequence
Identical sequences C9YSS1
gi|290954985|ref|YP_003486167.1| WP_012998333.1.11737 WP_012998333.1.15999 WP_012998333.1.2165 WP_012998333.1.21818 WP_012998333.1.32552 WP_012998333.1.82449 WP_012998333.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]