SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9YU40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9YU40
Domain Number 1 Region: 177-458
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.67e-29
Family Bacterial PLC 0.015
Further Details:      
 
Domain Number 2 Region: 43-166
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000476
Family Ricin B-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9YU40
Sequence length 465
Comment (tr|C9YU40|C9YU40_STRSW) Putative secreted protein {ECO:0000313|EMBL:CBG75169.1} KW=Complete proteome; Reference proteome OX=680198 OS=Streptomyces scabiei (strain 87.22). GN=SCAB_82131 OC=Streptomyces.
Sequence
MSLSRPHPRPRTRPRAHARALGAVAALTLGAPFAMPGTAAAAVPTHSVYLQNSVTGLNAA
AGGGTVAAHNPKGNEDHQQWTPVAVGGGHQLRNADQSGICLGRNGTSAVTAACGADGTTW
TVTEAAGSTYTIAVPGTAQYLTGVSSDSSLVQIGSNGDQARWYLTPVAPATTAIPSPGTR
TLDQVAFLTSHNAFANGADGNFASFPVSLFPNQSRGISRQLTDGVRGFMLDAYTVSGQAV
LCHNSCDGVGSPVPLATDLQRMVDFLKANPGQFATVFLEDYTSSDVLKASLASVRGLSDV
LYRPDQEGVATNGWPTMADLAARGKQLMVFSDRTRASDTSAGQATRNTFGVMYQREWTVE
NYWSMGGGLGGSDWSCYSRWGTSRPLTTDSAAFHPLFVMNHFRDYTISGTTETDNAKLGN
RAQNFCTPAARKKPNYLAVDRYELGSPSPLTTVADLNTYVLAAGQ
Download sequence
Identical sequences C9YU40
WP_013005609.1.11737 WP_013005609.1.94791 gi|290962511|ref|YP_003493693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]