SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9YX36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9YX36
Domain Number 1 Region: 203-561
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.3e-84
Family Amylase, catalytic domain 0.0044
Further Details:      
 
Domain Number 2 Region: 566-642
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000864
Family alpha-Amylases, C-terminal beta-sheet domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9YX36
Sequence length 671
Comment (tr|C9YX36|C9YX36_STRSW) (1->4)-alpha-D-glucan:maltose-1-phosphate alpha-D-maltosyltransferase {ECO:0000256|HAMAP-Rule:MF_02124} KW=Complete proteome; Reference proteome OX=680198 OS=Streptomyces scabiei (strain 87.22). GN=SCAB_83391 OC=Streptomyces.
Sequence
MSPIPAPAVGRVPVRDVRPLVECGRRPAKAVVGETFEVTATLFREGHGVVAANVVLKDPE
GRPAPWTTMRELAPGTDRWGACVTPTSVGRWTYRVEAWSDPIATWRHTARIKIPAGIDSG
LVLEEGAELYARAAAGVPEADLHAVLLTAVRRLRDDTVPVADRLAAALAPEVDEVLARHP
LRELVTSSEPLPLLVERERALFGSWYEFFPRSEGTPAQPHGTFRTAARRLPAIAAMGFDV
VYLPPIHPIGTTFRKGRNNTLSPTPDDVGVPWAIGSPEGGHDAVHPDLGTLDDFDHFISE
ARALGMEIALDFALQCSPDHPWVDKHPEWFHHRPDGTIAYAENPPKKYQDIYPIAFDADL
PGLVTETTRILRHWMDHGVRIFRVDNPHTKPVVFWEQVIADINATDPDVIFLAEAFTRPA
MMHTLAATGFQQSYTYFTWRTTKAELTEYATELAGEAAAYMRPNFFVNTPDILHAFLQEG
GRPAFELRAVLAATLSPTWGIYSGYELCENTPLKPGSEEYLDSEKYQLRPRDWDTAAHEG
RTIAPLITALNDIRRRHPALQGLRNLRFHHTDNDAVIAYSKRSGPDAVVVVVNLDPHRAQ
EATVTLDMPQLGLGAGDDVPVRDELTGESYRWGRTNYVRLEPGRAPAHVLHVHLPVDSTS
ASARTGGSATP
Download sequence
Identical sequences C9YX36
gi|290962633|ref|YP_003493815.1| WP_013005730.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]