SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9YYV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9YYV2
Domain Number 1 Region: 38-163
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.18e-41
Family Ricin B-like 0.0000135
Further Details:      
 
Domain Number 2 Region: 191-459
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.88e-25
Family Levansucrase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9YYV2
Sequence length 475
Comment (tr|C9YYV2|C9YYV2_STRSW) Putative secreted arabinofuranosidase {ECO:0000313|EMBL:CBG69407.1} KW=Complete proteome; Reference proteome OX=680198 OS=Streptomyces scabiei (strain 87.22). GN=SCAB_22931 OC=Streptomyces.
Sequence
MYRLSLSRRRPSAVLTAAIAALTALAAILVASPAQAATTSAVRGVASGRCLDVSGAGQTE
GTNVQIWDCHGGTNQQWTLTDGNQLTVYGNKCLDVPGHATAAGIRPVIWSCNGGTNQQWR
VNADGTVVAVESGLCLDVSGFGTANGTAVQLWNCTGADNQKWTGLSGATNSCPLPSTYRW
TSTGPLAQPANGWYSLKDFTTVTYNGKHLVYATNATADGWRSMMVSPFTNWSDMASAGQT
QTSQLAVAPRLFYFAPKNIWVLISNGWGTNWPFAYRTSSDPTNPNGWSAPQALFTGSLPA
GSKGSLIDPTIIGDGQNMVLFFADDAGSIYKSTMPIGNFPSSFGSSYTTVMKDTEDKLFE
AVEVYKVQGQNQYLMIVEAKGNNGRYFRSFTASSLNGPWTEQAGSESSPFAGKANSGATW
TNDISHGDLVRNNPDQTMTIDPCNLQFLYQGRDPNANDPDYLKLPYRPGLLTLQR
Download sequence
Identical sequences C9YYV2
WP_013000106.1.11737 WP_013000106.1.12502 WP_013000106.1.15999 WP_013000106.1.2165 WP_013000106.1.21818 WP_013000106.1.32552 WP_013000106.1.57887 WP_013000106.1.82449 WP_013000106.1.93747 WP_013000106.1.94791 gi|290956786|ref|YP_003487968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]