SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9Z035 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9Z035
Domain Number 1 Region: 32-334
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.43e-53
Family alpha-L-arabinanase-like 0.00000999
Further Details:      
 
Domain Number 2 Region: 340-474
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.44e-38
Family Ricin B-like 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9Z035
Sequence length 476
Comment (tr|C9Z035|C9Z035_STRSW) Putative secreted arabinase {ECO:0000313|EMBL:CBG75421.1} KW=Complete proteome; Reference proteome OX=680198 OS=Streptomyces scabiei (strain 87.22). GN=SCAB_84741 OC=Streptomyces.
Sequence
MTSQRAGGAFPEIRGRRVPPALAAILAALVVVMGLVTAGPAKALGGDVRMHDPSVIKVGH
CHYGFSTGFERDPLDPSGSLTIRKTCARTAATGWAKVGNVWETTPSWITAKLGATPPNIW
APDIAYFNGRYHLYYAGSRWGTNYAVMGLATAKHIEGPWTDQGMVTDVNYPIDPDVEKGP
HGRLYISWGSWTGSGTYMHALNPRTGKLSSTDNELRHVAINIENPTIIHNGGYYYLFGSK
GWCCNGVNSTYYTVVGRSTSITGPYLDRSGTGMLSDGGTTVLTGAYPKVAAGGADAFEDG
RSDFLAYHYYDGDNAGQETLDIRRVTFAGGWPVIAGPLGAAHNHLLNRNSGKCADVWYLS
TADDASVNSGNCNSGANQQWVSTPVGRNHQLVNVNSGKCLQVSGASTADGAAVVQSTCTG
APHQLWKRTPVIGGYVTFTNVRSGKCLEVAGASGDNGAALDQSTCAAGANHQWMVV
Download sequence
Identical sequences C9Z035
gi|290962762|ref|YP_003493944.1| WP_013005859.1.11737 WP_013005859.1.15999 WP_013005859.1.2165 WP_013005859.1.82449 WP_013005859.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]